PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_008724-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 323aa    MW: 34977.8 Da    PI: 9.9863
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_008724-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.46.6e-1394138347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + + lG+g+W+ I+r +   Rt+ q+ s+ qky
    NNU_008724-RA  94 PWTEEEHRTFLAGLESLGKGDWRGISRNFVPSRTPTQVASHAQKY 138
                      7*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.6972037IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.00487143IPR017930Myb domain
SuperFamilySSF466893.51E-1789142IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-1790142IPR006447Myb domain, plants
SMARTSM007171.9E-991141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-1192137IPR009057Homeodomain-like
CDDcd001671.07E-994139No hitNo description
PfamPF002494.5E-1094138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MWKRDGWNFS RVRMAKETVR KCSHCGNNGH NSRTCNEKFG LKLFGVRISK DKHMKKSLSM  60
GNLQSCTVEH NSGDPGYLSD GPVQARRERK KGIPWTEEEH RTFLAGLESL GKGDWRGISR  120
NFVPSRTPTQ VASHAQKYFL RQATSNRKKR RSSLFDDPSH TAPDLPLKPI IQFPEQAGTS  180
AQIAKQVAVR GLEGPTVVPV SATCTAPDFV GMPHMGGISC GKLTNPAATT DLPTASFIPA  240
VNHPILDYGY LPKACTTLAS TAISLESAFN LCPQPVMQCA SQAAPGTSAV NTDLELAIGP  300
PQAHNQTNLS SQTSNLSGAI RVV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258762.10.0PREDICTED: transcription factor MYB1R1-like isoform X2
TrEMBLA5BCS51e-72A5BCS5_VITVI; Putative uncharacterized protein
STRINGPGSC0003DMT4000556162e-58(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.13e-53MYB_related family protein